Protein coding transcript 10249

• Transcript: Ll_transcript_478101
• CDS coordinates: 539-973 (+)
• Peptide sequence: MYLASPDDRDDIGCVKSANNQSYTHNLVLQAKLDELRKKYPQSVILYADYWNAYRTIIKNPNQYGFTEVFKACCGSQDPPYNFSVFETCGTPNATACSSPSQYINWDGVHLTEAMYKVVSSMYLQGNFSQPPFNFLLEKKERQG*
• ORF Type: complete

Annotations of Ll_transcript_478101

• Blastp: GDSL esterase/lipase At3g48460 from Arabidopsis with 67.14% of identity
• Blastx: GDSL esterase/lipase At3g48460 from Arabidopsis with 67.48% of identity
• Eggnog: GDSL esterase lipase(ENOG410YD8Z)
• Kegg: Link to kegg annotations (AT3G48460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463736.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;