Protein coding transcript 102512

• Transcript: Ll_transcript_517229
• CDS coordinates: 244-729 (+)
• Peptide sequence: MMKPYIWLQTSDGSIQQVEQEIAKFCPLICQEIMQKGMGSSKNCAICLPQQVNPAMLSIVLDYCRFHQLPGRSNKERKSYDEKLIRMDTNRLCELTSAADSLKLRPLVDLTSRALARIIEGKTPEEIRDIFHIPDDLTEEEKLEPLKNITDDPRIRLLNRLY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_517229

• Blastp: SKP1-like protein 21 from Arabidopsis with 84.57% of identity
• Blastx: SKP1-like protein 21 from Arabidopsis with 84.05% of identity
• Eggnog: ubiquitin-dependent protein catabolic process(COG5201)
• Kegg: Link to kegg annotations (AT3G61415)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435224.1)
• Pfam: Skp1 family, tetramerisation domain (PF03931.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;