Transcript | Ll_transcript_517385 |
---|---|
CDS coordinates | 60-614 (+) |
Peptide sequence | MTSITSVEINFLIYRYLQESGFTHAAFAFGYEAGLNKSPIDGNSVPPSALVTFVQKGLQYFEMEANLTCQSDIDLEEDFSFLKPMDLITKDVNQLTQMINERRKKRQKDKNKGLEKEHGRERGRVREKERREREKDVVKDRKNVNNDNDKEQNQSHGDRTGREMVTDKEDMVVKLEKSGAFGGF* |
ORF Type | complete |
Blastp | WD40 repeat-containing protein HOS15 from Arabidopsis with 59.29% of identity |
---|---|
Blastx | WD40 repeat-containing protein HOS15 from Arabidopsis with 60.98% of identity |
Eggnog | f-box-like WD repeat-containing protein(ENOG410XRSY) |
Kegg | Link to kegg annotations (AT5G67320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458454.1) |
Pfam | LisH (PF08513.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer