Protein coding transcript 102528

• Transcript: Ll_transcript_517393
• CDS coordinates: 2-709 (+)
• Peptide sequence: NMTSITSVELNFLIYRYLQESGFTHSAFAFGYEAGLNKSPIDGNSVPPSALVTFVQKGLQYFEMEANLTCQSDIDLEEDFSFLKPMDLITKDVNQLTQMINERRKKRQKDKNKGLEKEHGRERGRVREKERREREKDVVKDRKNVNNDNDKEQNQSHGDRTGREMVTDKEDMVVKLEKSGAFGGPEPMDISTTSTSQPCEIPSSDVIVLEGHTSEVCACAWSPTGSLLASGWVSP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_517393

• Blastp: WD40 repeat-containing protein HOS15 from Arabidopsis with 47.39% of identity
• Blastx: WD40 repeat-containing protein HOS15 from Arabidopsis with 60.98% of identity
• Eggnog: f-box-like WD repeat-containing protein(ENOG410XRSY)
• Kegg: Link to kegg annotations (AT5G67320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458454.1)
• Pfam: LisH (PF08513.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;