Protein coding transcript 102585

• Transcript: Ll_transcript_517966
• CDS coordinates: 308-1066 (+)
• Peptide sequence: MDPSIVKLLEDDEDETMHSGVDLEAFQAALNRDIGGDASASQPSGSDNVLSQGSNNTFSQTIKQWPTSTLDKRADSQSQEPKTAQQQEQPSSEAELKQHVSLMEQPQHVASQILNNPPFSQKQSQDEFHQSQNIQVSVQNSQMSGIQSSGKDPVHNHEVVQTHNPSNESQYAKLQQISNQQDSFVEQPSSQMNHTNKQVPFGLLLPILIPQLPKDRAMQLQTLFTKLKVGFLLKPISLIGLVASSSYNVLLE*
• ORF Type: complete

Annotations of Ll_transcript_517966

• Blastp: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 42.31% of identity
• Blastx: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 41.2% of identity
• Eggnog: RNA polymerase II, TATA box binding protein (TBP)-associated factor(ENOG410XQS6)
• Kegg: Link to kegg annotations (AT5G43130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429836.1)
• Pfam: RCD1-SRO-TAF4 (RST) plant domain (PF12174.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;