Protein coding transcript 102589

• Transcript: Ll_transcript_517946
• CDS coordinates: 3-392 (+)
• Peptide sequence: SINKEQNIEHGSSNQVIVKDEFSRGLPASTSMPPTTSTGLPPHNSASPSVMTQPDPSVSIPSSTSGIMARTPVKKPFPAQKKPLEALGSSPPPSSKKQKTSGGSVEQSIEQLNDVTAVSGVDLREEEEQL
• ORF Type: internal

Annotations of Ll_transcript_517946

• Blastp: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 59.26% of identity
• Blastx: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 65.22% of identity
• Eggnog: RNA polymerase II, TATA box binding protein (TBP)-associated factor(ENOG410XQS6)
• Kegg: Link to kegg annotations (AT5G43130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431854.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;