Protein coding transcript 102911

• Transcript: Ll_transcript_519167
• CDS coordinates: 1403-2176 (+)
• Peptide sequence: MGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLETPSTTNKLPEDYVQRVKQVHESGGYGSRGYAYDWKREEANKNLLRTHTTAVSSRMLYQLAQKPFTPKKYFSIDRVFRNESVDRTHLAEFHQIEGLVCDRGLTLCDLIGVLHDFFSRMGMTKLKFKPAYNPYTEPSMEIFSYHEGFKKWVEVGNSGMFRPEMLQPMGLPEDVQVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLMKKNPICRLGIE*
• ORF Type: complete

Annotations of Ll_transcript_519167

• Blastp: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 67.1% of identity
• Blastx: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 87.73% of identity
• Eggnog: phenylalanyL-tRNA synthetase, alpha subunit(COG0016)
• Kegg: Link to kegg annotations (AT4G39280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448494.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;