Transcript | Ll_transcript_519167 |
---|---|
CDS coordinates | 1403-2176 (+) |
Peptide sequence | MGFEEMPTNNFVESSFWNFDALFQPQQHPARDSHDTFFLETPSTTNKLPEDYVQRVKQVHESGGYGSRGYAYDWKREEANKNLLRTHTTAVSSRMLYQLAQKPFTPKKYFSIDRVFRNESVDRTHLAEFHQIEGLVCDRGLTLCDLIGVLHDFFSRMGMTKLKFKPAYNPYTEPSMEIFSYHEGFKKWVEVGNSGMFRPEMLQPMGLPEDVQVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLMKKNPICRLGIE* |
ORF Type | complete |
Blastp | Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 67.1% of identity |
---|---|
Blastx | Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 87.73% of identity |
Eggnog | phenylalanyL-tRNA synthetase, alpha subunit(COG0016) |
Kegg | Link to kegg annotations (AT4G39280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448494.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer