Transcript | Ll_transcript_519180 |
---|---|
CDS coordinates | 204-701 (+) |
Peptide sequence | MLYQLAKKPFSPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLVCDRGLTLCDLIGVLHDFFSRMGMTKLKFKPAYNPYTEPSMEIFSYHEGFKKWVEVVNSGMFRPEMLQPMGLPEDVQVVAWGLSLEGQMMIQICLRIISSQQHLGFLLYILFLKCHMILILVFF* |
ORF Type | complete |
Blastp | Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 85.61% of identity |
---|---|
Blastx | Phenylalanine--tRNA ligase alpha subunit, cytoplasmic from Arabidopsis with 87.26% of identity |
Eggnog | phenylalanyL-tRNA synthetase, alpha subunit(COG0016) |
Kegg | Link to kegg annotations (AT4G39280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413281.1) |
Pfam | tRNA synthetases class II core domain (F) (PF01409.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer