Protein coding transcript 102999

• Transcript: Ll_transcript_288706
• CDS coordinates: 127-483 (+)
• Peptide sequence: MLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLLIVPFYETFSGKRWEKFNSEKVASLAYARIQGMTALVSHFQNSSLMNEDKRCRPILFHAEGPEAGDQVILDILLYIMVE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_288706

• Blastp: Protein MEI2-like 4 from Oryza sativa with 85.05% of identity
• Blastx: Protein MEI2-like 4 from Oryza sativa with 81.51% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (9271988)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417300.1)
• Pfam: RNA recognition motif 2 (PF04059.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;