Protein coding transcript 103005

• Transcript: Ll_transcript_288694
• CDS coordinates: 579-1649 (+)
• Peptide sequence: MKQSLDPSSLGTSMFRSINMPKEAGPAAWGVLSGSDSYYASSDASLFSSSLPVLPHEKLNLSDMKNSYQSSGFKKLHQDIPGNDSPEDVDTNAIGSMLPDDEEELLAGIMDDFDLSGLPGSLEDLEEYDLFGSGGGMELETDPQESLSVGMSKLSFSDSTTGNGLPLNSFPNGVGAVAGEHPLGEHPSRTLFVRNINSNVEDSELKALFEQYGDIRTLFTARKQRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDINQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRKCVY*
• ORF Type: complete

Annotations of Ll_transcript_288694

• Blastp: Protein MEI2-like 5 from Arabidopsis with 66.76% of identity
• Blastx: Protein MEI2-like 3 from Arabidopsis with 74.35% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: Link to kegg annotations (AT1G29400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415284.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;