Protein coding transcript 103073

• Transcript: Ll_transcript_288666
• CDS coordinates: 856-1296 (+)
• Peptide sequence: MWYCPGCKEHRQATKKLDLWKLPEILVFHLKRFSYSRYLKNKLDTFVNFPIHNLDLTKYVKTEDGQSYVYDLYAISNHYGGLGGGHYTAYAKMADDNKWYHFDDSHVSPVTEAEIKSSAAYVLFYQRRSKAQMEGESQFHTGSHRQ*
• ORF Type: complete

Annotations of Ll_transcript_288666

• Blastp: Ubiquitin carboxyl-terminal hydrolase 10 from Arabidopsis with 77.37% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 10 from Arabidopsis with 58.75% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(COG5560)
• Kegg: Link to kegg annotations (AT4G10570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431269.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF13423.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;