Transcript | Ll_transcript_289475 |
---|---|
CDS coordinates | 1481-2263 (+) |
Peptide sequence | MGDSFYEYLLKAWIQGNKTEAVKVYREMWETSMKGLESLVRKSTPSSFTYIAEKLGNELFHKMDELACFVPGMLALGSSGYSPGEASKFMSLAEELAWTCYNFYQSTPTKLAGENYFFRKGEDMTVGTSWNIQRPETIESLFYLWRLTGNKTYQEWGWDIFQAFENNSRSETGYVGLKDVTTGAKDNMMQSFFLAETLKYLYLLFSPPSIISLDEWVFNTEAHPLRIVTRNDPPEELSVDQEEKFPRHLYGRKEGRLDHK* |
ORF Type | complete |
Blastp | Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 from Arabidopsis with 79.52% of identity |
---|---|
Blastx | Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 from Arabidopsis with 78.86% of identity |
Eggnog | Mannosidase alpha class(ENOG410XP04) |
Kegg | Link to kegg annotations (AT1G51590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464414.1) |
Pfam | Glycosyl hydrolase family 47 (PF01532.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer