Protein coding transcript 103143

• Transcript: Ll_transcript_290021
• CDS coordinates: 562-1149 (+)
• Peptide sequence: MEIDLNHAVTEVEKNATCNEGCEKNACVITTLCSSTCSSLSSSYAPMSSSYLELWNACAGPLTSLPRKGNLVVYFPQGHMEQVATFSPFSTMEMPTYDLQPQIFCRVINVQLLANKENDEVYTQVTLLPQAELEGMYLESDEVEELGADEEGNVTTPTKSTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLV*
• ORF Type: complete

Annotations of Ll_transcript_290021

• Blastp: Auxin response factor 4 from Arabidopsis with 70.83% of identity
• Blastx: Auxin response factor 4 from Arabidopsis with 70.83% of identity
• Eggnog: auxin response factor(ENOG4111D9H)
• Kegg: Link to kegg annotations (AT5G60450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017425708.1)
• Pfam: Cysteine rich repeat (PF02363.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;