Protein coding transcript 103148

• Transcript: Ll_transcript_290031
• CDS coordinates: 394-951 (+)
• Peptide sequence: MEIDLNHAVTEVEKNAFCNGECDEKGACVCYLSSSNSTSSSSSYLELWHACAGPLTSLPKKGNVVVYFPQGHLEQVASFTPMEMPTYDLQPQIFCRVVNVHLLANKENDEVYTQVTLLPQAELEGMHLKGKELEELGSDEEGIGGTPKRLTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLV*
• ORF Type: complete

Annotations of Ll_transcript_290031

• Blastp: Auxin response factor 4 from Arabidopsis with 72.22% of identity
• Blastx: Auxin response factor 4 from Arabidopsis with 74.38% of identity
• Eggnog: auxin response factor(ENOG4111D9H)
• Kegg: Link to kegg annotations (AT5G60450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448714.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;