Transcript | Ll_transcript_290016 |
---|---|
CDS coordinates | 394-1296 (+) |
Peptide sequence | MEIDLNHAVTEVEKNAFCNGECDEKGACVCYLSSSNSTSSSSSYLELWHACAGPLTSLPKKGNVVVYFPQGHLEQVASFTPMEMPTYDLQPQIFCRVVNVHLLANKENDEVYTQVTLLPQAELEGMHLKGKELEELGSDEEGIGGTPKRLTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYKQLRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSRKNLISGDAVLFLRGENGELRLGIRRAVRLRNGLPESIVGNQNCYPNFLYSVANAISTKSIFRIFYSPRYK* |
ORF Type | complete |
Blastp | Auxin response factor 4 from Arabidopsis with 75.58% of identity |
---|---|
Blastx | Auxin response factor 4 from Arabidopsis with 65.01% of identity |
Eggnog | auxin response factor(ENOG4111D9H) |
Kegg | Link to kegg annotations (AT5G60450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448714.1) |
Pfam | B3 DNA binding domain (PF02362.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer