| Transcript | Ll_transcript_289999 |
|---|---|
| CDS coordinates | 2-334 (+) |
| Peptide sequence | PSHFISGVAAGGRGLNDFQESVRSPKVLQGQENSGFVSHYYGRDTVTNRSDFEMNSPSHPNLASTGGRKGISAELMSVHPLSYAAFVETNRFPRVLQGQEICPLNSLTGKI |
| ORF Type | internal |
| Blastp | Auxin response factor 4 from Arabidopsis with 46.39% of identity |
|---|---|
| Blastx | Auxin response factor 4 from Arabidopsis with 46.39% of identity |
| Eggnog | auxin response factor(ENOG4111D9H) |
| Kegg | Link to kegg annotations (AT5G60450) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448713.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer