Protein coding transcript 103217

• Transcript: Ll_transcript_287585
• CDS coordinates: 370-816 (+)
• Peptide sequence: MTGLKPSSTFSYKYGSDTVGWSDQIQFPTPPAGGAPEELKFIAYGDMGKTPLDKSDEHYIQPRALSVIKAIADDVKSNNINSIFHIGDISYATGFLVEWDYFLQLISPVASKLPNMTTIGNHERDYILFGSSYVTPDSGGECGVPYET*
• ORF Type: complete

Annotations of Ll_transcript_287585

• Blastp: Probable inactive purple acid phosphatase 24 from Arabidopsis with 40.52% of identity
• Blastx: Probable inactive purple acid phosphatase 27 from Arabidopsis with 39.01% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (AT4G24890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465289.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;