Transcript | Ll_transcript_289589 |
---|---|
CDS coordinates | 326-751 (+) |
Peptide sequence | MGRLGFYLPVIGMIGLQIHYAALAIFTRAALLDGLSPTVFVVYRQGIATLTLVPMAFSPKRRQSLKTSMGLRSFLLMFATSLIGVTANQNAYFKGLYYASSTAATAMSNLIPALTFVMAAIVGYLLFSLSFFIANCLVGKY* |
ORF Type | complete |
Blastp | WAT1-related protein At4g28040 from Arabidopsis with 51.69% of identity |
---|---|
Blastx | WAT1-related protein At4g28040 from Arabidopsis with 51.69% of identity |
Eggnog | EamA-like transporter family(ENOG411087W) |
Kegg | Link to kegg annotations (AT4G28040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453791.1) |
Pfam | EamA-like transporter family (PF00892.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer