Protein coding transcript 103248

• Transcript: Ll_transcript_289592
• CDS coordinates: 196-597 (+)
• Peptide sequence: MKFGPSPEKMAGRMEWAARSEHLRGIPRKIVIATVGAFSKTVSSFLNTTTVHNSDTLFRLLRSRPPTVPLITVSNHMSTLDDPFLWGFKGFPIFDTKLARWVLAAEDICFRNHFFSYLFRVGMSYFHNYVHCF*
• ORF Type: complete

Annotations of Ll_transcript_289592

• Blastp: N-acylphosphatidylethanolamine synthase from Arabidopsis with 66.67% of identity
• Blastx: N-acylphosphatidylethanolamine synthase from Arabidopsis with 66.67% of identity
• Eggnog: tafazzin(ENOG410XT5T)
• Kegg: Link to kegg annotations (AT1G78690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421009.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;