Protein coding transcript 103250

• Transcript: Ll_transcript_289575
• CDS coordinates: 326-910 (+)
• Peptide sequence: MGRLGFYLPVIGMIGLQIHYAALAIFTRAALLDGLSPTVFVVYRQGIATLTLVPMAFSPKRRQSLKTSMGLRSFLLMFATSLIGVTANQNAYFKGLYYASSTAATAMSNLIPALTFVMAAIVGFEKIGLRSLRSIAKILGTVCCVSGALTMALLKGQKLLHMDFLPFTHLTASESDNWQLGCLLLLASSVFWSCW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_289575

• Blastp: WAT1-related protein At4g28040 from Arabidopsis with 48.68% of identity
• Blastx: WAT1-related protein At4g28040 from Arabidopsis with 48.68% of identity
• Eggnog: EamA-like transporter family(ENOG411087W)
• Kegg: Link to kegg annotations (AT4G28040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453791.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;