Transcript | Ll_transcript_289584 |
---|---|
CDS coordinates | 2212-2685 (+) |
Peptide sequence | MENSRHRYLISVLLCQLHTFPEGKVYQDDTPIRRLKWGTASLIVRAPVTPIVLPIVHHGFQEVMPEKFMFGRRPLLPLCNKKIDIIIGEPIEFDLPKMKQKAISNSHNGPPFPTMGWPSTCDGLDEAAQRCLYTEISDQIRSALERLRCFGKQILKS* |
ORF Type | complete |
Blastp | N-acylphosphatidylethanolamine synthase from Arabidopsis with 59.15% of identity |
---|---|
Blastx | N-acylphosphatidylethanolamine synthase from Arabidopsis with 59.15% of identity |
Eggnog | tafazzin(ENOG410XT5T) |
Kegg | Link to kegg annotations (AT1G78690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421009.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer