Protein coding transcript 103265

• Transcript: Ll_transcript_289518
• CDS coordinates: 505-939 (+)
• Peptide sequence: MLMDYEKECMVRLFFFSCFAEHPWLQNAKKAPNVPLGDVVKSRLKQFSVMNRFKRKALRVIADFLSTEEVEDLKDMFKKMDSDNDGIVSIEELKVGFQSFGSQLADSEVQMLIEAVWSNLCFYFNLRCLKFWHDNVVTSSILCA*
• ORF Type: complete

Annotations of Ll_transcript_289518

• Blastp: Calcium-dependent protein kinase 13 from Arabidopsis with 86.46% of identity
• Blastx: Calcium-dependent protein kinase 13 from Arabidopsis with 80.34% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT3G51850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463985.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;