Protein coding transcript 103279

• Transcript: Ll_transcript_289837
• CDS coordinates: 265-573 (+)
• Peptide sequence: MAKKPGPRPSKLSVYLYIPNIIGYIRVLLNCTAFYLCFTNKILFSVLYFFSFVCDAVDGWAARKFNQGINFLVQVIVSSYLSENLLRYLFEKFIPFDFVVHV*
• ORF Type: complete

Annotations of Ll_transcript_289837

• Blastp: CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 from Arabidopsis with 77.46% of identity
• Blastx: CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 from Arabidopsis with 71.76% of identity
• Eggnog: cdp-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase(COG0558)
• Kegg: Link to kegg annotations (AT1G68000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450990.1)
• Pfam: CDP-alcohol phosphatidyltransferase (PF01066.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;