Transcript | Ll_transcript_289852 |
---|---|
CDS coordinates | 265-585 (+) |
Peptide sequence | MAKKPGPRPSKLSVYLYIPNIIGYIRVLLNCTAFYLCFTNKILFSILYFFSFVCDAVDGWAARKFNQGINFIVQILVSAYLSKNQLRYLFEKHVPFQYVVHVQGES* |
ORF Type | complete |
Blastp | CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 from Arabidopsis with 65.62% of identity |
---|---|
Blastx | CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 from Arabidopsis with 76.06% of identity |
Eggnog | cdp-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase(COG0558) |
Kegg | Link to kegg annotations (AT1G68000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451190.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer