Transcript | Ll_transcript_318433 |
---|---|
CDS coordinates | 2-334 (+) |
Peptide sequence | NKVEEYFSSIGIVVPDRVNPPDYYIDILEGIVKLPESSGVNYKQLPVRWMLHNGYPVPMDMLATVEGMATPGEGSAHGAATTTGNAEDTSFAGELWQDVKCNVELKKDNLQ |
ORF Type | internal |
Blastp | ABC transporter G family member 28 from Arabidopsis with 74.56% of identity |
---|---|
Blastx | ABC transporter G family member 28 from Arabidopsis with 74.56% of identity |
Eggnog | (ABC) transporter(COG1131) |
Kegg | Link to kegg annotations (AT5G60740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453941.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer