Protein coding transcript 1033

• Transcript: Ll_transcript_318433
• CDS coordinates: 2-334 (+)
• Peptide sequence: NKVEEYFSSIGIVVPDRVNPPDYYIDILEGIVKLPESSGVNYKQLPVRWMLHNGYPVPMDMLATVEGMATPGEGSAHGAATTTGNAEDTSFAGELWQDVKCNVELKKDNLQ
• ORF Type: internal

Annotations of Ll_transcript_318433

• Blastp: ABC transporter G family member 28 from Arabidopsis with 74.56% of identity
• Blastx: ABC transporter G family member 28 from Arabidopsis with 74.56% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT5G60740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453941.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;