Transcript | Ll_transcript_288473 |
---|---|
CDS coordinates | 763-1161 (+) |
Peptide sequence | MIQFKESVSQFASENIAPHASKIDHTNYFPKEINLWKSMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVGLSYGAHSNLCINQLVRNGSPAQKEKYLPKVLVLPILILFIISKIHAAFPYCRLS* |
ORF Type | complete |
Blastp | Isovaleryl-CoA dehydrogenase, mitochondrial from Oryza sativa with 81.31% of identity |
---|---|
Blastx | Isovaleryl-CoA dehydrogenase, mitochondrial from Arabidopsis with 86.41% of identity |
Eggnog | Dehydrogenase(ENOG410XNMY) |
Kegg | Link to kegg annotations (4337676) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413615.1) |
Pfam | Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer