Protein coding transcript 103344

• Transcript: Ll_transcript_288484
• CDS coordinates: 143-586 (+)
• Peptide sequence: MLHRINTARSFCAKVLRTKPHSAAAFSTSLLFDETQIQFKESVSQFASENIAPHASKIDHTNYFPKEINLWKSMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVGLSYGAHSNLCINQLVIEGNLRLFNYKLGDHVISL*
• ORF Type: complete

Annotations of Ll_transcript_288484

• Blastp: 2-methylacyl-CoA dehydrogenase, mitochondrial from Solanum with 66.92% of identity
• Blastx: Isovaleryl-CoA dehydrogenase, mitochondrial from Oryza sativa with 86.79% of identity
• Eggnog: Dehydrogenase(ENOG410XNMY)
• Kegg: Link to kegg annotations (102589539)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413615.1)
• Pfam: Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;