Protein coding transcript 103355

• Transcript: Ll_transcript_288467
• CDS coordinates: 763-1254 (+)
• Peptide sequence: MIQFKESVSQFASENIAPHASKIDHTNYFPKEINLWKSMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVGLSYGAHSNLCINQLVRNGSPAQKEKYLPKLISGDHVGALAMSEPNSGSDVVSMKCKADRVDGGYVLNGNKMWCTNGPVAQTLVCL*
• ORF Type: complete

Annotations of Ll_transcript_288467

• Blastp: Isovaleryl-CoA dehydrogenase, mitochondrial from Arabidopsis with 91.25% of identity
• Blastx: Isovaleryl-CoA dehydrogenase, mitochondrial from Arabidopsis with 91.81% of identity
• Eggnog: Dehydrogenase(ENOG410XNMY)
• Kegg: Link to kegg annotations (AT3G45300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413614.1)
• Pfam: Acyl-CoA dehydrogenase, C-terminal domain (PF00441.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;