Protein coding transcript 103378

• Transcript: Ll_transcript_287483
• CDS coordinates: 1447-2025 (+)
• Peptide sequence: MSDVYSFGVVLLELLTGRRSVEKGRPQREKNLVEWARPYLNDSRKLSRIMDPRLEGQYSDMGAKKAAALAYLCLSHRAKSRPTMTTVVKTLEPLQDFDDIPIGPFVYTVPSDKGEGNKDTKESGTLKERKRENVGHNHHRSHHHSNGHRHHPLKSPKTPNSKLQNDIHQNGRSGSTSPTDISFASEGQGIKL*
• ORF Type: complete

Annotations of Ll_transcript_287483

• Blastp: Serine/threonine-protein kinase RIPK from Arabidopsis with 73.64% of identity
• Blastx: Serine/threonine-protein kinase RIPK from Arabidopsis with 60.31% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455203.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;