Protein coding transcript 103380

• Transcript: Ll_transcript_287486
• CDS coordinates: 906-1727 (+)
• Peptide sequence: MKIAVGAAKGLAFLHEAQKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYVMTGHLTTMSDVYSFGVVLLELLTGRRSVEKGRPQREKNLVEWARPYLNDSRKLSRIMDPRLEGQYSDMGAKKAAALAYLCLSHRAKSRPTMTTVVKTLEPLQDFDDIPIGPFVYTVPSDKGEGNKDTKESGTLKERKRENVGHNHHRSHHHSNGHRHHPLKSPKTPNSKLQNDIHQNGRSGSTSPTDISFASEGQGIKL*
• ORF Type: complete

Annotations of Ll_transcript_287486

• Blastp: Serine/threonine-protein kinase RIPK from Arabidopsis with 79.69% of identity
• Blastx: Serine/threonine-protein kinase RIPK from Arabidopsis with 72.47% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464503.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;