Protein coding transcript 103384

• Transcript: Ll_transcript_287492
• CDS coordinates: 216-647 (+)
• Peptide sequence: MTVMKITWKSIFPSCYKGDDDYQSPKPNKVVSSPPKTTKPDGSSSRISVTDLSFPTTTLSEDLSISLAGSNLHVFTLAELKIITQGFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHKEWLVSNIHYL*
• ORF Type: complete

Annotations of Ll_transcript_287492

• Blastp: Serine/threonine-protein kinase RIPK from Arabidopsis with 64.49% of identity
• Blastx: Serine/threonine-protein kinase RIPK from Arabidopsis with 79% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464503.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;