Transcript | Ll_transcript_287492 |
---|---|
CDS coordinates | 216-647 (+) |
Peptide sequence | MTVMKITWKSIFPSCYKGDDDYQSPKPNKVVSSPPKTTKPDGSSSRISVTDLSFPTTTLSEDLSISLAGSNLHVFTLAELKIITQGFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHKEWLVSNIHYL* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase RIPK from Arabidopsis with 64.49% of identity |
---|---|
Blastx | Serine/threonine-protein kinase RIPK from Arabidopsis with 79% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G05940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464503.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer