Protein coding transcript 103385

• Transcript: Ll_transcript_287493
• CDS coordinates: 214-783 (+)
• Peptide sequence: MKIAVGAAKGLAFLHEAQKPVIYRDFKASNILLDSNYGAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKGRPQREQNLVEWARPYLNDFRKLSRIMDPRLEGQYSEMGAKKATALAYLCLSHRPRSRPTMTTVVKTLEPLQDFDDIPIGPFVYTV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_287493

• Blastp: Serine/threonine-protein kinase RIPK from Arabidopsis with 82.11% of identity
• Blastx: Serine/threonine-protein kinase RIPK from Arabidopsis with 83% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455203.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;