Protein coding transcript 103390

• Transcript: Ll_transcript_287499
• CDS coordinates: 1502-2080 (+)
• Peptide sequence: MSDVYSFGVVLLELLTGRRSVDKGRPQREQNLVEWARPYLNDFRKLSRIMDPRLEGQYSEMGAKKATALAYLCLSHRPRSRPTMTTVVKTLEPLQDFDDIPIGPFVYTVPSDNGEGNKDAKESDTPKEKKRESGGHNHHHRSHHRNNGHRHHPLKSPKTPNSMSQSDKDKNGRSVSTSPDTSIASESQGSKV*
• ORF Type: complete

Annotations of Ll_transcript_287499

• Blastp: Serine/threonine-protein kinase RIPK from Arabidopsis with 66.93% of identity
• Blastx: Serine/threonine-protein kinase RIPK from Arabidopsis with 65.13% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G05940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455203.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;