Protein coding transcript 103398

• Transcript: Ll_transcript_287487
• CDS coordinates: 120-791 (+)
• Peptide sequence: MASLLPMSYPSLPFSQQKWLQTKPNSNTNTSLLIQCCHNQRNPIQVTSNAMSYPEKNPIIKIPPRPRRIILVRHGESEGNVDESLYTRVADPKIALTEKGKVQAEECGHRIKNLIEKDADKSWQLYFYVSPYRRALETLKSLARPFERSTIAGFREEPRIREQDFGNFQDKEKMQVEKEMRMRYGRFFYRFPNGESAADVYDRITGKFANESNSYHFVQVEYN*
• ORF Type: complete

Annotations of Ll_transcript_287487

• Blastp: Phosphoglycerate mutase-like protein AT74 from Arabidopsis with 58.16% of identity
• Blastx: Phosphoglycerate mutase-like protein AT74 from Arabidopsis with 57.35% of identity
• Eggnog: Phosphoglycerate mutase(ENOG4111HP2)
• Kegg: Link to kegg annotations (AT3G05170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003517475.1)
• Pfam: Histidine phosphatase superfamily (branch 1) (PF00300.21)
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;