Transcript | Ll_transcript_287373 |
---|---|
CDS coordinates | 665-1183 (+) |
Peptide sequence | MNERVRRACANSCADFVYGFLETSAKKGSEYWLVWRFEGDATLADLVQSRDFPYNVETLILGEIQDLPKGLERENRIIQTIMRQLLFALDSLHSTGIVHRDIKPQNIIFSEGSRTFKIIDLGAAADLRVGINYIPKEFLLDPRYLLTEMFPLQLDIRKLNFTSKLKCPYHSY* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase STN7, chloroplastic from Arabidopsis with 82% of identity |
---|---|
Blastx | Serine/threonine-protein kinase STN7, chloroplastic from Arabidopsis with 78.79% of identity |
Eggnog | Cyclin-Dependent Kinase(ENOG410XPP3) |
Kegg | Link to kegg annotations (AT1G68830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429954.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer