Transcript | Ll_transcript_289738 |
---|---|
CDS coordinates | 3-1100 (+) |
Peptide sequence | YIKRKRERERERERKKERMVSDEEISEALKCVWRESKGVRLSNLNQLLQLLQSKLGVHDLSPNLHFITQQIHLLFGSQQPPQPHQQQPQQQQQQPPQHQHQQPPPPEDHFALHHNPNFQTSPTALPASSSILNFSSATVSPLAHASAAPTQPHSLPATTHLPNQGIQPKAKRRGGPGGLNKLCGVSPELQVIVGHPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIITLEPTKQPVPKKQKVEAESGTISAQPAPLVIISDALANFFGIAGREMLQSEVLRRIWEYIKVKQLEVSNEELEFILISRSGFAAFIKFSIKLMIIVDQLDKPSIYCRFVNY* |
ORF Type | 5prime_partial |
Blastp | Upstream activation factor subunit spp27 from Schizosaccharomyces with 36.42% of identity |
---|---|
Blastx | Upstream activation factor subunit spp27 from Schizosaccharomyces with 46.99% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPCC285.17) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426199.1) |
Pfam | SWIB/MDM2 domain (PF02201.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer