Protein coding transcript 103446

• Transcript: Ll_transcript_288235
• CDS coordinates: 2-583 (+)
• Peptide sequence: SNIFPPYGWGGSLHRRSCSVNDACLGSEDPSSGFGWKPCLYFARGYCKNGTSCRFLHGGGGGGGTLADADAAMAGSPSKIEMMDELLRSKTAQHQRLAAASQLMASSFPYSPKGINFLLQQQQNDSPRGAVAALMMNEELHKYGRSRLERNDFSLNSPGIVSPASRQIYLTFPADSTFREEDVSNYFSIYGPVQ
• ORF Type: internal

Annotations of Ll_transcript_288235

• Blastp: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 54.07% of identity
• Blastx: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 53.59% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410YCDX)
• Kegg: Link to kegg annotations (4332722)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450855.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;