Protein coding transcript 103447

• Transcript: Ll_transcript_288237
• CDS coordinates: 62-595 (+)
• Peptide sequence: MASSFPYSPKCMNFLLQQQQNDSPRGAVAALMMNEELHKFGRSRLERNDFSLHSPGIVNPASRQIYLTFPADSTFREEDVSNYFSIYGPVQDVRIPYQQKRMFGFVTFVYPETVKLILSKGNPHFVCDARVLVKPYKEKGKVPDKYRHLLFLPFLFIFSLLIVSHICSELFLLFYMW*
• ORF Type: complete

Annotations of Ll_transcript_288237

• Blastp: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 71.43% of identity
• Blastx: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 72.33% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410YCDX)
• Kegg: Link to kegg annotations (4332722)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413005.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;