Transcript | Ll_transcript_288221 |
---|---|
CDS coordinates | 3-353 (+) |
Peptide sequence | KVPDKYRKQQQQLDRGDFSPCGTPTGLDARDQFDLQLGGRMFYNTQDMLWRRKLEEQADFQQALELQSRRLMSLQLLDIKKQHHRTLSTGSPIPSPTHSPSMFNQNLVFPSFHGSSE |
ORF Type | internal |
Blastp | Zinc finger CCCH domain-containing protein 53 from Oryza sativa with 55.34% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 53 from Oryza sativa with 63.16% of identity |
Eggnog | zinc finger CCCH domain-containing protein(ENOG410YCDX) |
Kegg | Link to kegg annotations (4344312) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450852.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer