Transcript | Ll_transcript_288224 |
---|---|
CDS coordinates | 2-607 (+) |
Peptide sequence | SNIFPPYGWGGSLHRRSCSVNDACLGSEDPSSGFGWKPCLYFARGYCKNGTSCRFLHGGGGGGGTLADADAAMAGSPSKIEMMDELLRSKTAQHQRLAAASQLMASSFPYSPKGINFLLQQQQNDSPRGAVAALMMNEELHKYGRSRLERNDFSLNSPGIVSPASRQIYLTFPADSTFREEDVSNYFRFFFLLCNNEYGCA* |
ORF Type | 5prime_partial |
Blastp | Zinc finger CCCH domain-containing protein 53 from Oryza sativa with 43.71% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 47.13% of identity |
Eggnog | zinc finger CCCH domain-containing protein(ENOG410YCDX) |
Kegg | Link to kegg annotations (4344312) |
CantataDB | Link to cantataDB annotations (CNT0000302) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003533499.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer