Protein coding transcript 103450

• Transcript: Ll_transcript_288227
• CDS coordinates: 62-820 (+)
• Peptide sequence: MASSFPYSPKCMNFLLQQQQNDSPRGAVAALMMNEELHKFGRSRLERNDFSLHSPGIVNPASRQIYLTFPADSTFREEDVSNYFSIYGPVQDVRIPYQQKRMFGFVTFVYPETVKLILSKGNPHFVCDARVLVKPYKEKGKVPDKKQQVDRGDFSPCGTPTGLDARDQFDLQLGGRMFYNTQDMLWRRKLEEQADFQQALELQSRRLMSLQLLDIKKQHHRTLSTGSPIPSPTHSPSMFNQNLVFPSFHGSSE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_288227

• Blastp: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 65.27% of identity
• Blastx: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 67.8% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410YCDX)
• Kegg: Link to kegg annotations (4332722)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413004.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;