Protein coding transcript 103451

• Transcript: Ll_transcript_288228
• CDS coordinates: 480-935 (+)
• Peptide sequence: MFGFVTFVYPETVKLILSKGNPHFVCDARVLVKPYKEKGKVPDKKQQVDRGDFSPCGTPTGLDARDQFDLQLGGRMFYNTQDMLWRRKLEEQADFQQALELQSRRLMSLQLLDIKKQHHRTLSTGSPIPSPTHSPSMFNQNLVFPSFHGSSE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_288228

• Blastp: Zinc finger CCCH domain-containing protein 55 from Arabidopsis with 55.47% of identity
• Blastx: Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 77.06% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG411182H)
• Kegg: Link to kegg annotations (AT5G12440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413004.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;