Transcript | Ll_transcript_288233 |
---|---|
CDS coordinates | 62-1120 (+) |
Peptide sequence | MASSFPYSPKCMNFLLQQQQNDSPRGAVAALMMNEELHKFGRSRLERNDFSLHSPGIVNPASRQIYLTFPADSTFREEDVSNYFSIYGPVQDVRIPYQQKRMFGFVTFVYPETVKLILSKGNPHFVCDARVLVKPYKEKGKVVDKKQQQLDRGDFSPCGTPIGLDARDPFDLQIGGGRMYYNSQDMAWRRTSEEQSDFQQALELQSRRLMSLQLLDIKKQHERALSTGSPIPSPTLSPNMFNQNLGFSSFHSNSESPEDSGLGSAPASTASIPVDLQMQQTVNISVGKEVAVSGENEKSDFQEWYLTFSHFDQYVTKNSSHFFPPNSLVHAKSSMHLFMFSNLYDLIYTRSV* |
ORF Type | complete |
Blastp | Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 58.01% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 22 from Oryza sativa with 65.85% of identity |
Eggnog | zinc finger CCCH domain-containing protein(ENOG410YCDX) |
Kegg | Link to kegg annotations (4332722) |
CantataDB | Link to cantataDB annotations (CNT0000302) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413005.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer