Transcript | Ll_transcript_287928 |
---|---|
CDS coordinates | 160-927 (+) |
Peptide sequence | MATLSETYACVPTTERGRGILISGDSKSNNILYCTARSVIIRNLDNPLQVSVYGEHAYPVTVARYSPNGEWIASADVSGTVRIWGTHNDFVLKNEFRVLSGRIDDLQWSQDGLRIVACGDGKGKSFVRAFMWDSGSTVGDFDGHSRRVLSCAFKPTRPFRIVTCGEDFLANFYEGPPFKFNMSIRDHSNFVNCVRFSPDGSKFITVSSDRKGIIYDGKTGNKLGELSAEDGHKGSIYAVSWSPDSKQVSSCLCLNV |
ORF Type | 3prime_partial |
Blastp | Actin-interacting protein 1-2 from Arabidopsis with 83.27% of identity |
---|---|
Blastx | Actin-interacting protein 1-2 from Arabidopsis with 83.27% of identity |
Eggnog | actin filament depolymerization(ENOG410XQN1) |
Kegg | Link to kegg annotations (AT3G18060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441466.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer