Protein coding transcript 103541

• Transcript: Ll_transcript_287928
• CDS coordinates: 160-927 (+)
• Peptide sequence: MATLSETYACVPTTERGRGILISGDSKSNNILYCTARSVIIRNLDNPLQVSVYGEHAYPVTVARYSPNGEWIASADVSGTVRIWGTHNDFVLKNEFRVLSGRIDDLQWSQDGLRIVACGDGKGKSFVRAFMWDSGSTVGDFDGHSRRVLSCAFKPTRPFRIVTCGEDFLANFYEGPPFKFNMSIRDHSNFVNCVRFSPDGSKFITVSSDRKGIIYDGKTGNKLGELSAEDGHKGSIYAVSWSPDSKQVSSCLCLNV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_287928

• Blastp: Actin-interacting protein 1-2 from Arabidopsis with 83.27% of identity
• Blastx: Actin-interacting protein 1-2 from Arabidopsis with 83.27% of identity
• Eggnog: actin filament depolymerization(ENOG410XQN1)
• Kegg: Link to kegg annotations (AT3G18060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441466.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;