Protein coding transcript 103544

• Transcript: Ll_transcript_287919
• CDS coordinates: 3-401 (+)
• Peptide sequence: PSKEKKSIEKRGGFVSNIPGDVPRVDGQLAVARAFGDKSLKKHLSSEPDVFQVEIDQHTEFLILASDGIWKVMSNQEAVDSIRQIKDAEAAAKHLIEEAISKKNHSIDDLKSQEPNFVAELDMGKGGDSKDL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_287919

• Blastp: Probable protein phosphatase 2C 58 from Arabidopsis with 80.77% of identity
• Blastx: Probable protein phosphatase 2C 58 from Arabidopsis with 80.77% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G28400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453708.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;