Protein coding transcript 103584

• Transcript: Ll_transcript_288272
• CDS coordinates: 1-339 (+)
• Peptide sequence: LQTPALPPQPVSRFIVFPRLQYSTMATIPVNPKPFLNNLTGKHVIVKLKWGMEYKGYLVSVDSYMNLQLANTEEYIEGQFTGNLGEILIRCNNVLYLRGVPEDEEIEDAPED*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_288272

• Blastp: Probable small nuclear ribonucleoprotein F from Arabidopsis with 88.64% of identity
• Blastx: Probable small nuclear ribonucleoprotein F from Arabidopsis with 90.79% of identity
• Eggnog: small nuclear ribonucleoprotein(ENOG4111W47)
• Kegg: Link to kegg annotations (AT4G30220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442315.1)
• Pfam: LSM domain (PF01423.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;