Protein coding transcript 103586

• Transcript: Ll_transcript_288275
• CDS coordinates: 2-298 (+)
• Peptide sequence: PLFPGVSGMLALRQSWCNWMLEINMFLNCFTCSEADEIYKICSVLGSPTTESWADGLKLARDINYQFPQLAGVQLSSLIPSAGVDAISLITSLCSWDPC
• ORF Type: internal

Annotations of Ll_transcript_288275

• Blastp: Cyclin-dependent kinase F-4 from Oryza sativa with 56.72% of identity
• Blastx: Cyclin-dependent kinase F-4 from Oryza sativa with 56.72% of identity
• Eggnog: Male germ cell-associated kinase(ENOG410XPBB)
• Kegg: Link to kegg annotations (4330434)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421613.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;