Transcript | Ll_transcript_287450 |
---|---|
CDS coordinates | 117-1517 (+) |
Peptide sequence | MAGIASEELGVGKSVEGISSVQHCQSVEALAEWRSSEQVENGITSTSPPYWDTDDDDDGPKPGDLYGKNTWKIEKFSQITKRELRSNAFEVGGYKWYILIYPQGCDVCNHLSLFLCVANHDKLLPGWSHFAQFTIAVVNKDPKKSKYSDTLHRFWKKEHDWGWKKFMEISKVYDGFVDNSDNLIIKAQVQVIREKADRPFRCLDCQYRRELVRVYLTNVEQICRRFVEERRGKLGKLIEDKARWLSFCTFWRDIDQTSRRRMSREKTDVILKVVVKHFFIEKEVTSTLVMDSLYSGLKALECQTKCKKDRMKLLDTEEMAPPIVCVEKDMFVLVDDVLLLLERAAIEPLPPKDEKGPQNRTKDGSSGEDFNKDSIELDERRLTELGRKTLEIFVLAHVFSNKIEVSYQEAVALKRQEELIREEEAAWLAESEQKAKRAVNEKEKKSKKKQAKQKRNNRKGKDKGREE |
ORF Type | 3prime_partial |
Blastp | MATH domain-containing protein At5g43560 from Arabidopsis with 75.23% of identity |
---|---|
Blastx | MATH domain-containing protein At5g43560 from Arabidopsis with 75.29% of identity |
Eggnog | math domain-containing protein(ENOG410ZKXJ) |
Kegg | Link to kegg annotations (AT5G43560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449965.1) |
Pfam | MATH domain (PF00917.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer