Protein coding transcript 103600

• Transcript: Ll_transcript_287454
• CDS coordinates: 198-1016 (+)
• Peptide sequence: MTGIVSEESGVGKSVDGISSGQRYNSVEALAEWRSSEQVENGVTSTSPPYWDTDDEDDCGMKPSELYGKYTWRIEKFSQITKRELRSNAFEVAGYKWYILIYPQGCDVCNHLSLFLCVANHDKLLPGWSHFAQFTIAVVNKDPKKSKYSDTLHRFWKKEHDWGWKKFMELSKVYDGFVDTSDNLIIKAQVQVIREKSDRPFRGLDYQYRRELVRVYLTNVEQICRRFVEERRSKLGKLIEDKARWSRYFVLSFKSVSHEVYVSIYFVTCCMP*
• ORF Type: complete

Annotations of Ll_transcript_287454

• Blastp: MATH domain-containing protein At5g43560 from Arabidopsis with 75.1% of identity
• Blastx: MATH domain-containing protein At5g43560 from Arabidopsis with 75.1% of identity
• Eggnog: math domain-containing protein(ENOG410ZKXJ)
• Kegg: Link to kegg annotations (AT5G43560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461140.1)
• Pfam: MATH domain (PF00917.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;