Protein coding transcript 10361

• Transcript: Ll_transcript_432461
• CDS coordinates: 42-512 (+)
• Peptide sequence: MNLICFSWIFQMHMWGHGSQYRKGPDSLKGTQPTAMLRLPCFCCAPGCKHNIDHPRSKPLKDFRTLQTHYKRKHGIKPYMCRKCSKAFAVKGDWRTHEKNCGKIWYCLCGSDFKHKRSLKDHIKAFGYGHGVFGMDSPQEEDEATSEIEHYEESSL*
• ORF Type: complete

Annotations of Ll_transcript_432461

• Blastp: Zinc finger protein WIP2 from Arabidopsis with 81.25% of identity
• Blastx: Zinc finger protein WIP2 from Arabidopsis with 81.25% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT3G57670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450451.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;